PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000788581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 147aa    MW: 16658.3 Da    PI: 10.0562
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000788581genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.97.7e-32461360
                   -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY  3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
                   Dg++WrKYGqK+v+g+++prsYYrCts +C+v+k+ve+ ++dpk++++tYeg+Hnh+k
  MDP0000788581  4 DGFRWRKYGQKVVQGNPYPRSYYRCTSLKCSVRKHVETVSDDPKAFITTYEGKHNHDK 61
                   9*******************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081132.638162IPR003657WRKY domain
SMARTSM007748.6E-35261IPR003657WRKY domain
SuperFamilySSF1182907.19E-27362IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-30362IPR003657WRKY domain
PfamPF031062.3E-25460IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MTCDGFRWRK YGQKVVQGNP YPRSYYRCTS LKCSVRKHVE TVSDDPKAFI TTYEGKHNHD  60
KPLRNMNAGS SEKDTTTKEK PRLSDNITFK LWHQTVSTPC LSDKNVIWAQ RKKHTPKVTV  120
AVILIPALDA LLCYAMPIIS LGNLFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-304621977Probable WRKY transcription factor 4
2lex_A4e-304621977Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.116542e-76stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201091e-102KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338560.14e-48PREDICTED: WRKY transcription factor 44-like
RefseqXP_009338561.14e-48PREDICTED: WRKY transcription factor 44-like
TrEMBLX2F1V25e-47X2F1V2_9R
STRINGVIT_08s0040g03070.t011e-35(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.28e-31WRKY family protein